PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006425P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 268aa    MW: 30714.5 Da    PI: 7.1934
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006425P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
   MELO3C006425P1 14 KGPWTAEEDEILISYINKHGHSNWRALPKLAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.72.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e+ ++++++lG++ W++Ia+ ++ gRt++++k++w+++l
   MELO3C006425P1  67 RGNFTLEEQEIVLHLHEKLGNR-WSAIAAQLP-GRTDNEIKNFWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.782961IPR017930Myb domain
SuperFamilySSF466892.85E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001671.68E-111661No hitNo description
PROSITE profilePS5129426.662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1567112IPR001005SANT/Myb domain
CDDcd001678.92E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MVRAPCCEKL GLKKGPWTAE EDEILISYIN KHGHSNWRAL PKLAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TLEEQEIVLH LHEKLGNRWS AIAAQLPGRT DNEIKNFWHT HLKKRVSNKQ  120
TGHVHAKKKS ADSAVFEPKS KPQKLDCSNH YEIPSFSLDH SPFTDSPTGY KVIENEQDVE  180
IFEAFHQTCT GGHWPEDHQP LTENFHGSLF NSSAINDNEE QIQPPYRAMD SVEFGCYYNN  240
STKMDDNMEF WYRVFVKAGG SPNDPAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438526.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0S2I8B41e-159A0A0S2I8B4_CITLA; Myb-related transcription factor
STRINGGLYMA02G00820.11e-83(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.15e-77myb domain protein 14